PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A01041.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 506aa    MW: 55084.5 Da    PI: 7.6082
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A01041.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR421.8e-1366103139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     k+kk+CnC++skClk+YCeCf+++++C+  C+C++C N 
  Pahal.A01041.1  66 KKKKHCNCRNSKCLKMYCECFQEQQFCDG-CNCSNCGNI 103
                     589**************************.******996 PP

2TCR49.77.3e-16151190140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeC++a++ Cs++C+C dCkN e
  Pahal.A01041.1 151 KHNKGCHCKKSGCLKKYCECYQANVLCSKNCRCMDCKNFE 190
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011149.7E-1266106IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.09267191IPR005172CRC domain
PfamPF036384.6E-1068102IPR005172CRC domain
SMARTSM011142.0E-18151192IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.2E-12154189IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MEQGKNQQHP QQQQPKPAVL AAAGEMKAPA VAPQQPKPAA PAMPVPRQWP MAFNPPSTEA  60
KSVTPKKKKH CNCRNSKCLK MYCECFQEQQ FCDGCNCSNC GNIVGNEKAR QEAINAIVQR  120
NPLAFQPKIE NGPSTHNVRK DNSGAVPLVP KHNKGCHCKK SGCLKKYCEC YQANVLCSKN  180
CRCMDCKNFE GSEERKALIQ GDYASDGNQI QQAASVALNG TIGSSGYNCS PVRRKRSHED  240
TLGPRINSEG SMPETQFLQG NHADVSLLAP SSTGFDGHNA ANSQSKSYNP IYRSPLANTI  300
HLTEVNDLVT HMVTACRMAA ATIADNKVNG TTVENQFHVN GGLSNGNCKQ QELKEASQMD  360
ILRRGCSDQP NINEIDSHWS DTAKDSRPAS PTTQALMCDE QETTFGNDYR CSFPSVSCDQ  420
DISEINAAQE NLVLTGLREY LRVIITRGKI KEHKSSSEAA MEPDGQQHHG ATPIAPREVG  480
ENAPSNCAET PRTDQQPTQN AGSER*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952204.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
TrEMBLK3YRR50.0K3YRR5_SETIT; Uncharacterized protein
STRINGSi016959m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57552653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.13e-94Tesmin/TSO1-like CXC domain-containing protein